PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do023232.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 284aa    MW: 28975.2 Da    PI: 9.4153
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do023232.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.73.4e-3554108660
      zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                  +cprC s++tkfCyynny+++qPr+fC+aCrryWt GG+lrnvPvGg++rk+ +
  Do023232.1  54 EQCPRCASRDTKFCYYNNYNTAQPRHFCRACRRYWTLGGSLRNVPVGGSTRKRPR 108
                 68*************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.4E-3054106IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.61554108IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2155101IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105692IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEAPLHQSPV PPPPLQDAAI SAALLQQAEA AARAMMMVAQ KKQQPAAAAQ LGREQCPRCA  60
SRDTKFCYYN NYNTAQPRHF CRACRRYWTL GGSLRNVPVG GSTRKRPRPA RPTRAIAAAV  120
AASSAAAAAN ATTTTSSSPC FASSTMAAPV PLAPPSPGGL LGSLLLGLGS ASPLLALGSA  180
PLLEGRLGSD DLGLGQPPAL LNTGAGDLAQ LGFGAGPFLW PAATTTVLEG EHRAETAAWK  240
SGSACPLQLP LPPPGALWQE LAAAAPPVEA GGLLRHGGSP HLLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104108KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6616594e-76AY661659.1 Sorghum bicolor clone BAC 75D9, complete sequence.
GenBankHQ5400844e-76HQ540084.1 Sorghum bicolor clone SbDof1 Dof-type zinc finger protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008661525.14e-63PREDICTED: dof zinc finger protein DOF1.6-like
TrEMBLA0A096S6754e-63A0A096S675_MAIZE; Uncharacterized protein
STRINGGRMZM2G131897_P011e-62(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.16e-24DOF zinc finger protein 1